From: Jer Noble Date: Thu, 26 Apr 2012 17:19:47 +0000 (-0700) Subject: Added .vimrc. X-Git-Url: http://www.sha.pley.net/dotfiles.git/commitdiff_plain/25bfdff2cb6ecc3c4a695fd032bb1e5f6c4c65ff Added .vimrc. --- diff --git a/.vimrc b/.vimrc new file mode 100644 index 0000000..d27a4df --- /dev/null +++ b/.vimrc @@ -0,0 +1,1573 @@ +version 5.3 +" ================================================================== +" File: $HOME/.vimrc +" Availability: This file is available as +" ~20K +" ~56K +" (mirror) +" Size: This file is about 57K in size and has 1,500+ lines. +" Purpose: Setup file for the editor Vim (Vi IMproved) +" Author: Sven Guckes guckes@vim.org (guckes@math.fu-berlin.de) +" +" Related files: +" http://www.math.fu-berlin.de/~guckes/vim/src/latex.vim +" http://www.math.fu-berlin.de/~guckes/vim/src/html.vim +" http://www.math.fu-berlin.de/~guckes/vim/syntax/ +" Note: Please send comments to me - email preferred! :-) +" Last update: Thu Dec 10 02:02:02 CET 1998 +" =================================================================== +" The latest versions of Vim are usually in my signature file: +" http://www.math.fu-berlin.de/~guckes/sig/SIGS Have a look! +" =================================================================== +" Note to Windows users: Get these files from any Vim mirror: +" vim52rt.zip (840K) vim runtime files (docs + syntax files) +" gvimw32.zip (440K) gvim - precompiled binary for Windows 32bit +" These should fit onto one floppy. Just a recommendation. +" =================================================================== +" Installation of this setup file: +" +" To use this setup file, copy it to +" this filename on these systems: +" ~/.vimrc Unix and OS/2 +" s:.vimrc Amiga +" $VIM\_vimrc MS-DOS and Win32 +" +" NOTE: This setup file uses a lot of features of Vim-5. +" If you are still using Vim-4 (or an even older version) +" then you should upgrade - it is really worth the effort! +" To find out why get Vim-5 and read ":help version5". +" +" The first line of this setup file contains the information +" "version xxx" which allows VIM to check whether the setup file +" fits the syntax that it understands. +" Versions of VIM other than of version 5 then will give a warning +" as they do not understand this setup file command - a feature: +" Give a warning so the user knows that there is something odd +" about the setup file. +" =================================================================== +" Whitespace meta sequence: +" vim-5.0s introduced the meta sequence "\s" which stands for "whitespace" +" ie either a space or a tab. This makes mappings a lot easier. +" I have therefore updated my mappings to use this sequence. +" But this is incompatible with previous versions and, of course, Vi. +" =================================================================== +" Info on the latest versions is on the Vim HomePage: +" http://www.vim.org/ - which is a daily mirror of the pages at +" http://www.math.fu-berlin.de/~guckes/vim/ +" and in Sven's signature file: +" http://www.math.fu-berlin.de/~guckes/sig/SIGS +" =================================================================== +" =================================================================== +" Structure of this file: +" Lines starting with an inverted comma (") are comments. +" Some mappings are commented out. Remove the comment to enable them. +" +" There are three kinds of things which are defined in this file: +" Mapping ("map"), settings ("set"), and abbreviations ("ab"). +" Settings affect the behaviour of commands. +" Mappings maps a key sequence to a command. +" Abbreviations define words which are replaced +" right *after* they are typed in. +" +" =================================================================== +" Note on mappings - "angle notation" (see ":help <>"): +" VIM allows you to define mappings with special characters +" with a notation that uses non-special characters: +" The notation encloses decriptive words in angle brackets (<>). +" The characters you will most often are: +" for control-m +" for control-v which quotes the following character +" for the escape character. +" All control characters have been replaced to use the angle notation +" so you should be able to read this file without problems. +" (Well, sometimes I leave some tabs [control-i] in the file. ;-) +" =================================================================== +" External programs: +" Some mappings make use of external programs. +" The following you should find on every UNIX system: +" awk, egrep, grep, ispell, perl, sed. +" If you are using DOS then you should get these for you system!! +" Programs that are supplied with the mailer ELM: elmalias, readmsg. +" To get these look at page +" http://www.math.fu-berlin.de/~guckes/elm/dist.html +" One major advantage of vim-5 (actually, 5.0g) is that there is now +" the internal function "strftime". This allows to insert the current +" date and time in various format. Example: mapping ",L" (see below) +" =================================================================== +" SETtings +" =================================================================== +" +" autoindent: "off" as I usually do not write code. + set noautoindent +" +" autowrite: "on" saves a lot of trouble + set autowrite +" +" backup: backups are for wimps ;-) + set nobackup +" +" backspace: '2' is much smarter. + set backspace=2 +" +" background: Are we using a "light" or "dark" background? + set background=dark +" +" compatible .... + set nocompatible +" +" comments default: sr:/*,mb:*,el:*/,://,b:#,:%,:XCOMM,n:>,fb:- + set comments=b:#,:%,fb:-,n:>,n:) +" +" cpoptions you should get to know - source of many FAQs! ;-) +" cpoptions: "compatible options" to match Vi behaviour +" set cpoptions="aABceFs" "default! +" FAQ: Do NOT include the flag '<' if you WANT angle notation! +" +" dictionary: english words first + set dictionary=/usr/dict/words,/local/lib/german.words +" +" digraph: required for those umlauts + set digraph +" +" errorbells: damn this beep! ;-) + set noerrorbells + +" esckeys: allow usage of cursor keys within insert mode + set esckeys +" +" formatoptions: Options for the "text format" command ("gq") +" I need all those options (but 'o')! + set formatoptions=cqrt +" +" helpheight: zero disables this. + set helpheight=0 +" +" helpfile: filename of the helpfile +" set helpfile=c:\\vim-4.6\\docs\\help.txt +" this is where I usually put it on DOS; sometimes is required +" to set as the default installation does not find it :-( +" +" hidden: + set hidden +" +" highlight=8b,db,es,hs,mb,Mn,nu,rs,sr,tb,vr,ws + set highlight=8r,db,es,hs,mb,Mr,nu,rs,sr,tb,vr,ws +" +" hlsearch : highlight search - show the current search pattern +" This is a nice feature sometimes - but it sure can get in the +" way sometimes when you edit. + set nohlsearch +" +" icon: ... + set noicon +" +" set iconstring file of icon (Sven doesn't use an icon) +" set iconstring +" +" ignorecase: ignore the case in search patterns? NO! + set noignorecase +" +" insertmode: start in insert mode? Naah. + set noinsertmode +" +" +" iskeyword: Add the dash ('-'), the dot ('.'), and the '@' +" as "letters" to "words". +" iskeyword=@,48-57,_,192-255 (default) + set iskeyword=@,48-57,_,192-255,-,.,@-@ +" +" joinspaces: insert two spaces after a period with every +" joining of lines. This is very nice! + set joinspaces +" +" keywordprg: Program to use for the "K" command. +" set keywordprg=man\ -s +" +" laststatus: show status line? Yes, always! +" laststatus: Even for only one buffer. + set laststatus=2 +" +" [VIM5]lazyredraw: do not update screen while executing macros + set lazyredraw +" +" magic: use some magic in search patterns? Certainly! + set magic +" +" modeline: ... +" Allow the last line to be a modeline - useful when +" the last line in sig gives the preferred textwidth for replies. + set modeline + set modelines=1 +" +" number: ... + set nonumber +" +" path: The list of directories to search when you specify +" a file with an edit command. +" Note: "~/.P" is a symlink to my dir with www pages +" "$VIM/syntax" is where the syntax files are. + set path=.,,~/.P/vim,~/.P/vim/syntax,~/.P/vim/source,$VIM/syntax/ +" set path=.,,~/.P/vim,~/.P/mutt/,~/.P/elm,~/.P/slrn/,~/.P/nn +" +" report: show a report when N lines were changed. +" report=0 thus means "show all changes"! + set report=0 +" +" ruler: show cursor position? Yep! + set ruler +" +" Setting the "shell" is always tricky - especially when you are +" trying to use the same vimrc on different operatin systems. +" shell for DOS +" set shell=command.com +" shell for UNIX - math.fu-berlin.de BSD +" set shell=zsh +" shell for UNIX - inf.fu-berlin.de BSD&Solaris +" set shell=zsh +" shell for UNIX - zedat.fu-berlin.de BSD&Solaris +" set shell=/bin/tcsh +" zsh now available at zedat! :-) +" set shell=zsh +" Now that vim-5 has ":if" I am trying to automate the setting: +" + if has("dos16") || has("dos32") + let shell='command.com' + endif + if has("unix") + let shell='zsh' + endif +" +" shiftwidth: Number of spaces to use for each +" insertion of (auto)indent. + set shiftwidth=8 +" +" shortmess: Kind of messages to show. Abbreviate them all! +" New since vim-5.0v: flag 'I' to suppress "intro message". + set shortmess=at +" +" showcmd: Show current uncompleted command? Absolutely! + set showcmd +" +" showmatch: Show the matching bracket for the last ')'? + set showmatch +" +" showmode: Show the current mode? YEEEEEEEEESSSSSSSSSSS! + set showmode +" +" suffixes: Ignore filename with any of these suffixes +" when using the ":edit" command. +" Most of these are files created by LaTeX. + set suffixes=.aux,.bak,.dvi,.gz,.idx,.log,.ps,.swp,.tar +" +" startofline: no: do not jump to first character with page +" commands, ie keep the cursor in the current column. + set nostartofline +" +" tabstop + set tabstop=8 +" +" +" Set the colors for vim on "xterm" + if &term=="xterm" + set t_Co=8 " "terminal has eight colors" + set t_Sb=[4%dm " escape sequence for background + set t_Sf=[3%dm " escape sequence for foreground +" source ~/.P/vim/syntax/colors.vim +" http://www.math.fu-berlin.de/~guckes/vim/syntax/colors.vim +" [todo] Add this to the Vim FAQ + endif +" +" textmode: no - I am using Vim on UNIX! + set notextmode +" +" textwidth + set textwidth=79 +" +" title: + set notitle +" +" ttyfast: are we using a fast terminal? +" seting depends on where I use Vim... + set nottyfast +" +" ttybuiltin: + set nottybuiltin +" +" ttyscroll: turn off scrolling -> faster! + set ttyscroll=0 +" +" ttytype: +" set ttytype=rxvt +" +" viminfo: What info to store from an editing session +" in the viminfo file; can be used at next session. + set viminfo=%,'50,\"100,:100,n~/.viminfo +" +" visualbell: + set visualbell +" +" t_vb: terminal's visual bell - turned off to make Vim quiet! +" Please use this as to not annoy cow-orkers in the same room. +" Thankyou! :-) + set t_vb= +" +" whichwrap: + set whichwrap=<,> +" +" wildchar the char used for "expansion" on the command line +" default value is "" but I prefer the tab key: + set wildchar= +" +" wrapmargin: + set wrapmargin=1 +" +" writebackup: + set nowritebackup +" +" =================================================================== +" ABbreviations +" =================================================================== +" 980701: Moved the abbreviations *before* the mappings as +" some of the abbreviations get used with some mappings. +" +" Abbreviations for some important numbers: + iab Npi 3.1415926535897932384626433832795028841972 + iab Ne 2.7182818284590452353602874713526624977573 +" +" Abbreviations for some classic long words: +" +" Donau... is the German word for the (read in reverse) +" "additional paragraph of the law regulating the pension of +" widows to captains of the ship company on (the river) Danube" +" (I am not making this up! ;-) + iab YDD Donaudampfschiffahrtgesellschaftskapitaenwitwenrentengesetzzusatzparagraph +" +" YLL : The name of a town in Wales. I am not making this up! + iab YLL LLanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch +" http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk +" http://194.159.85.168/ - I am not making this up! :-) +" +" YTauma: The name of a hill in New Zealand. + iab YTauma Taumatawhakatangihangakoauauotamateaturipukakapikimaungahoronukupokaiwenuakitanatahu +" +" Yalpha : The lower letter alphabet. + iab Yalpha abcdefghijklmnopqrstuvwxyz +" +" YALPHA : The upper letter alphabet. + iab YALPHA ABCDEFGHIJKLMNOPQRSTUVWXYZ +" +" Ydigit : The ten digits. + iab Ydigit 1234567890 +" +" Yruler : A ruler. + iab Yruler 1234567890123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890 +" +" Yupsidedown : This describes people from "down under" +" (Hi, Dean!). + iab Yupsidedown umop-ap!sdn +" +" Ysuper: A nice long word from the musical "Mary Poppins". + iab Ysuper supercalifragilisticexpialidocious + +" Yanti: The longest proper word in the English language?! + iab Yanti antidisestablishmentarianism +" +" Ypass : Standard answer to Usenet posts +" with the "Subject: HELP" (hehe) + iab Ypass "You are in a maze of twisty little passages, all alike." +" +" Ysesqui : "Sesquipedalophobia" means "fear of big words." ;-) + iab Ysesqui sesquipedalophobia +" +" classic pangrams (which include every letter of the alphabet): +" German: +" sylvia wagt quick den jux bei pforzheim +" bayerische jagdwitze von maxl querkopf +" zwei boxkaempfer jagen eva quer durch sylt +" kaufen sie jede woche vier gute bequeme pelze +" falsches üben von xylophonmusik quält jeden größeren zwerg. +" Bei jedem klugen Wort von Sokrates rief Xanthippe zynisch: Quatsch! +" English: +" the quick brown fox jumps over the lazy dog +" French: +" voyez le brick geant que j'examine pres du wharf. +" +" And a sentence to break some quoing levels: +" "This man's house (which 's yellow) burned down." +" +" And now for something completely different: +" I couldn't bear to bear bears over the border. +" +" Inserting an ellipsis to indicate deleted text + iab Yell [...] + vmap ,ell c[...] +" +" Correcting those typos. [I almost never get these right. :-(] +" See also: http://www.igd.fhg.de/~zach/programs/acl/ + iab alos also + iab aslo also + iab charcter character + iab charcters characters + iab exmaple example + iab shoudl should + iab seperate separate + iab teh the +" Some frequent typos in German: + iab nciht nicht + iab doer oder + iab Dreckfuhler Druckfehler +" Sorry, Laurent! + iab Laurant Laurent +" +" See http://www.math.fu-berlin.de/~guckes/sig/: + iab YDDS dash-dash-space +" +" For reports and texts on my studies: + iab YKT Komplexitaetstheorie + iab YRA Rechnerarchitektur + iab YPM Pattern Matching +" see http://elib.zib.de/ICM98 : + iab YICM International Congress of Mathematicians +" +" Some sentences that I really use often in emails about Vim: + iab YAW You are welcome! :-) + iab YEV Enjoy Vim! +" +" Often used filenames - only needed these on the command line: +" see also: http://www.math.fu-berlin.de/~guckes/setup/ +" + cab ELMALIAS ~/.elm/aliases.text + cab Erc ~/.elm/elmrc + cab Mrc ~/.muttrc + cab Src ~/.slrnrc + cab Zrc ~/.zsh/.zshrc + cab SIGs ~/.P/sig/SIGS +" +" A list of filenames that are needed to shorten some autocommands: +" cab MAILNEWSFILES .article,.followup,.letter,mutt*[0-9],/postpone/* +" cab MAILNEWSFILES *.article,*.followup,*.letter,*mutt* +let MAILNEWSFILES = "*.article,*.followup,*.letter,mutt*" +" +" see also: http://www.math.fu-berlin.de/~guckes/sig/SIGS +" +" Email Adresses: +" I usually use these when adding addresses to the header +" of emails (mutt) and posts (slrn). +" +" Author of the Good NetKeeping Seal of Approval: + ab Agnksa js@xs4all.nl (Jeroen Scheerder) +" +" Author of Mutt: + ab Amutt me@cs.hmc.edu (Michael Elkins) +" +" Author of Slrn: + ab Aslrn davis@space.mit.edu (John E. Davis) +" +" Author of Vim: +" ab Avim mool@oce.nl (Bram Moolenaar) + ab Avim bram@vim.org (Bram Moolenaar) +" +" Former Maintainer of the Vim FAQ: + ab Avimfaq laurent@Grafnetix.COM (Laurent Duperval) +" +" Mailing Lists (MLs) +" +" The Vim mailing lists: See http://www.vim.org/mail.html for more info! + ab MLvim vim@vim.org (VIM Help List) + ab MLvimdev vim-dev@vim.org (VIM Development List) + ab MLvimmac guckes-vimmac@math.fu-berlin.de (VIM on MacOS Development List) +" +" More mailing lists: + ab MLgnksa gnksa-workers@babayaga.math.fu-berlin.de (GNKSA Workers List) + ab MLmuttdev mutt-dev@mutt.org (Mutt Developer List) + ab MLmuttuser mutt-users@mutt.org (Mutt Users List) + ab MLzsh zsh-users@math.gatech.edu (ZShell Users List) +" +" +" News: newsgroup names +" +" Newsgroup about "warloding" of signatures - see +" also http://www.math.fu-berlin.de/~guckes/afw/ + iab Nafw alt.fan.warlord + iab Nahbou alt.humor.best-of-usenet + iab Nzedat bln.announce.fub.zedat.d + iab Ncsd bln.announce.fub.cs.d + iab Nce comp.editors +" Newsgroup about "lynx": + iab Nhtml comp.infosystems.www.authoring.html +" Newsgroup about "elm": Elm is dead - long live Mutt! + iab Nelm comp.mail.elm +" Newsgroup about "pine": When will they release pine-4? +" iab Ncmp comp.mail.pine + iab Npine comp.mail.pine +" iab Ncsmd comp.sys.mac.digest +" Newsgroup about "mobil phone systems": + iab Ndcm de.comm.mobil + iab Nmobil de.comm.mobil +" Newsgroup about "web browsers": + iab Nlynx comp.infosystems.www.browsers.misc + iab Nnetscape comp.infosystems.www.browsers.misc +" Newsgroup about "mutt" [since 980401]: The coolest mail user agent + iab Nmutt comp.mail.mutt +" Newsgroup about "nn": Once was the best newsreader. Still good. + iab Nnn news.software.nn +" Newsgroup for "newbies". +" All you ever wanted to know - but were afraid to ask. ;-) + iab Newbie news.newusers.questions +" Newsgroup about "newsreader *agents*" (netscape and slrn): + iab Nnsr news.software.readers +" +" Usenet header lines (used when composing a post): +" + iab UFT Followup-To: + iab UMCT Mail-Copies-To: MYADDR + iab UNG Newsgroups: + iab URT Reply-To: MYADDR + iab UFUB Organization: Freie Universitaet Berlin +" +" Current version numbers of my favourite programs: +" http://www.math.fu-berlin.de/~guckes/sig/SIGS +" And some abbreviations to type them in mail&news: +" + iab Velm ELM2.4PL25 [951204] + iab VElm ELM2.5b2 [980213] + iab Vlynx lynx-2.8.0 [980310 + iab Vmutt mutt-0.92.8 [980514] + iab Vslrn slrn-0.9.5.2 [980503] + iab Vvim vim-5.1 [980407] + iab Vvimdev vim-5.2c [980518] +" +" For current version numbers take a look at my signature file: +" http://www.math.fu-berlin.de/~guckes/sig/SIGS +" +" My snail mail address, phone numbers, and email->pager gateway: +" Postcards and FAXes are welcome (especially with cartoons :-). +" If you want, you can send a message to my pager by email, too. + iab Ypager To: ums@teco.eduSubject: PAGE:01777777796 + iab Yphone TEL/FAX (+49 30) 8838884Cellphone (+49 177) 7777796 + iab Ysnail Sven GuckesPariser Str. 52D-10719 Berlin +" +" My addresses (Email and WWW) +" makes it easy to type them without typos ;-) + ab Amaili guckes@inf.fu-berlin.de + ab Amailm guckes@math.fu-berlin.de + ab Amailv guckes@vim.org + ab Amailz guckes@zedat.fu-berlin.de + ab MYADDR guckes@math.fu-berlin.de + ab MYNAME Sven Guckes +" +" Setting the reply address when replying as the guy from SKB: + ab ASKB Sprachboerse +" See also: http://www.math.fu-berlin.de/~guckes/skb/ +" +" My Home Pages at the departments at the FUB +" + ab WWWm http://www.math.fu-berlin.de/~guckes/ + ab WWWi http://www.inf.fu-berlin.de/~guckes/ + ab WWWz http://userpage.zedat.fu-berlin.de/~guckes/ +" +" WWW Pages base URLs +" + ab HPA http://www.math.fu-berlin.de/~guckes/afw/ + ab HPa http://www.math.fu-berlin.de/~guckes/ascii/ + ab HPc http://www.math.fu-berlin.de/~guckes/calvin/ + ab HPD http://www.math.fu-berlin.de/~guckes/dos/ + ab HPe http://www.math.fu-berlin.de/~guckes/eplus/ab.faq.html + ab HPE http://www.math.fu-berlin.de/~guckes/elm/ + ab HPI http://www.math.fu-berlin.de/~guckes/irc/ + ab HPi http://www.math.fu-berlin.de/~guckes/ispell/ + ab HPL http://www.math.fu-berlin.de/~guckes/lynx/ + ab HPl http://www.math.fu-berlin.de/~guckes/less/ + ab HPm http://www.math.fu-berlin.de/~guckes/mail/ + ab HPM http://www.math.fu-berlin.de/~guckes/mutt/ + ab HPN http://www.math.fu-berlin.de/~guckes/nn/ + ab HPP http://www.math.fu-berlin.de/~guckes/pine/ + ab HPp http://www.math.fu-berlin.de/~guckes/procmail/ + ab HPr http://babayaga.math.fu-berlin.de/~rxvt/ + ab HPR http://www.math.fu-berlin.de/~guckes/rfc/ + ab HPs http://www.math.fu-berlin.de/~guckes/screen/ + ab HPS http://www.math.fu-berlin.de/~guckes/slrn/ + ab HPv http://www.math.fu-berlin.de/~guckes/vi/ +" HPOV - the "original" URL of the Vim Home Page! + ab HPOV http://www.math.fu-berlin.de/~guckes/vim/ + ab HPV http://www.vim.org/ + ab HPX http://www.math.fu-berlin.de/~guckes/xmas/ + ab HPZ http://www.math.fu-berlin.de/~guckes/zsh/ +" +" Other important WWW addresses +" + ab URLutefuchs http://www.math.fu-berlin.de/~utefuchs/ + ab URLaltavista http://altavista.digital.com/ + ab URLftpsearch http://ftpsearch.ntnu.no/ftpsearch/ + ab URLvimfaq http://www.grafnetix.com/~laurent/vim/faq.html + ab URLbambi http://www.math.fu-berlin.de/~leitner/CnH/bambi.html + ab URLsecret http://www.math.fu-berlin.de/~leitner/CnH/secret.html + ab URLwhome http://www.math.fu-berlin.de/~leitner/CnH/who.me.html + ab URLstopspam http://www.math.fu-berlin.de/~guckes/pics/stop.this.spam.jpg + ab FTPFUB ftp://ftp.fu-berlin.de/ + ab FTPVIM ftp://ftp.fu-berlin.de/pub/misc/editors/vim/ +" +" =================================================================== +" Abbreviations - Header Lines for Email and News +" =================================================================== +" Define regexpr for headers to use with mappings +" as it makes reading the mappings much easier: +" cab HADDR From\\|Cc\\|To + cab HEMAIL ^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|Message-Id\\|X-\) + cab HNEWS ^\(From\\|Cc\\|To\\|Date\\|Subject\\|Message-ID\\|X-\\|Newsgroups\) +" +" =================================================================== +" Abbreviations - General Editing - Inserting Dates and Times +" =================================================================== +" +" First, some command to add date stamps (with and without time). +" I use these manually after a substantial change to a webpage. +" [These abbreviations are used with the mapping for ",L".] +" + iab Ydate =strftime("%y%m%d") +" Example: 971027 +" + iab Ytime =strftime("%H:%M") +" Example: 14:28 +" + iab YDT =strftime("%y%m%d %T") +" Example: 971027 12:00:00 +" + iab YDATE =strftime("%a %b %d %T %Z %Y") +" Example: Tue Dec 16 12:07:00 CET 1997 +" +" On Windows the functions "strftime" seems to have a different +" format. Therefore the following may be necessary: [980730] +" if !has("unix") +" iab YDATE =strftime("%c %a") +" else +" iab YDATE =strftime("%D %T %a") +" endif +" +" =================================================================== +" MAPpings +" =================================================================== +" Caveat: Mapping must be "prefix free", ie no mapping must be the +" prefix of any other mapping. Example: "map ,abc foo" and +" "map ,abcd bar" will give you the error message "Ambigous mapping". +" +" The backslash ('\') is the only(?) unmapped key, so this is the best +" key to start mappings with as this does not take away a command key. +" However, the backslash is never in the same position with keyboards. +" Eg on German keyboards it is AltGr-sz - don't ask. +" Anyway, I have decided to start mappings with the comma as this +" character is always on the same position on almost all keyboards +" and I hardly have a need for that command. +" +" The following maps get rid of some basic problems: +" +" With Vim-4 the format command was just 'Q' and +" I am too used to it. So I need this back! + nnoremap Q gq + vnoremap Q gq +" +" 980527 I often reformat a paragraph to fit some textwidth - +" and I use the following mapping to adjust it to the +" current position of the cursor: + map #tw :set textwidth==col(".") +" +" 981210 Whenever I paste some text into VIM I have to +" toggle from "nopaste" to "paste" and back again: +" map :set paste!:set paste? + map [14~ :set paste!:set paste? +" +" "tal" is the "trailer alignment" filter program +" Hopefully it will ship with Vim one day. +" vmap #t !tal +" vmap #t !tal -p 0 +" +" Disable the command 'K' (keyword lookup) by mapping it +" to an "empty command". (thanks, Lawrence! :-): +" map K : + map K : +" +" Disable the suspend for ^Z. +" I use Vim under "screen" where a suspend would lose the +" connection to the " terminal - which is what I want to avoid. + map :shell +" +" Make CTRL-^ rebound to the *column* in the previous file + noremap `" +" +" Make "gf" rebound to last cursor position (line *and* column) + noremap gf gf`" +" +" When I let Vim write the current buffer I frequently mistype the +" command ":w" as ":W" - so I have to remap it to correct this typo: + nmap :W :w +" +" Are you used to the Unix commands "alias" and "which"? +" I sometimes use these to look up my abbreviations and mappings. +" So I need them available on the command line: + map :alias map + map :which map +" +" The command {number}CTRL-G show the current nuffer number, too. +" This is yet another feature that vi does not have. +" As I always want to see the buffer number I map it to CTRL-G. +" Pleae note that here we need to prevent a loop in the mapping by +" using the comamnd "noremap"! + noremap 2 +" +" 980311 Sourcing syntax files +" My personal syntax files are in ~/.P/vim/syntax/ +" and I need a quick way to edit and source them. + map ,SO :so ~/.P/vim/syntax/ +" +" 980706 Sourcing syntax files from the distribution +" A nice and fast way to both source syntax files +" and to take a look at "what's there": + map ,V :so $VIM/syntax/ +" +" =================================================================== +" Customizing the command line +" =================================================================== +" Valid names for keys are: +" +" +" Many shells allow editing in "Emacs Style". +" Although I love Vi, I am quite used to this kind of editing now. +" So here it is - command line editing commands in emacs style: + cnoremap + cnoremap + cnoremap +" cnoremap + cnoremap b + cnoremap f + cnoremap +" +" Additional codes for that "English" keyboard at the Xterminal + cnoremap [D + cnoremap [C +" +" Some editing is helpful in insert mode, too: + inoremap + inoremap +" +" Make the up and down movements move by "display/screen lines": +" map j gj +" map gj +" map k gk +" map gk +" +" =================================================================== +" VIM - Editing and updating the vimrc: +" As I often make changes to this file I use these commands +" to start editing it and also update it: + if has("unix") + let vimrc='~/.vimrc' + else +" ie: if has("dos16") || has("dos32") || has("win32") + let vimrc='$VIM\_vimrc' + endif + nn ,u :source =vimrc + nn ,v :edit =vimrc +" ,v = vimrc editing (edit this file) +" map ,v :e ~/.vimrc +" ,u = "update" by reading this file +" map ,u :source ~/.vimrc +" =================================================================== +" +" General Editing +" +" Define "del" char to be the same backspace (saves a LOT of trouble!) +" As the angle notation cannot be use with the LeftHandSide +" with mappings you must type this in *literally*! + map 127 + cmap 127 +" the same for Linux Debian which uses + imap [3~ + imap  +" +" ;rcm = remove "control-m"s - for those mails sent from DOS: + cmap ;rcm %s///g +" +" Make whitespace visible: +" Sws = show whitespace + nmap ,Sws :%s/ /_/g + vmap ,Sws :%s/ /_/g +" +" Sometimes you just want to *see* that trailing whitespace: +" Stws = show trailing whitespace + nmap ,Stws :%s/ *$/_/g + vmap ,Stws :%s/ *$/_/g +" +" General Editing - Turning umlauts into ascii (for German keyboards) +" +" imap ä ae +" imap ö oe +" imap ü ue +" imap ß ss +" +" Ä -> Ä :%s/\Ä/Ä/gc -> D +" Ö -> Ö :%s/\Ö/Ö/gc -> V +" Ü -> Ü :%s/\Ü/Ü/gc -> \ +" ä -> ä :%s/\ä/ä/gc -> d +" ö -> ö :%s/\ö/ö/gc -> v +" ü -> ü :%s/\ü/ü/gc -> | +" +" =================================================================== +" Inserting Dates and Times / Updating Date+Time Stamps +" =================================================================== +" ,L = "Last updated" - replace old time stamp with a new one +" preserving whitespace and using internal "strftime" command: +" requires the abbreviation "YDATE" + map ,L 1G/Last update:\s*/e+1CYDATE + map ,,L 1G/Last change:\s*/e+1CYDATE +" Example: +" before: "Last update: Thu Apr 6 12:07:00 CET 1967" +" after: "Last update: Tue Dec 16 12:07:00 CET 1997" +" +" ,L = "Last updated" - replace old time stamp with a new one +" using external "date" command (not good for all systems): +" map ,L 1G/Last update: */e+1D:r!datekJ +" +" =================================================================== +" General Editing - link to program "screen" +" =================================================================== +" +" ,Et = edit temporary file of "screen" program + map ,Et :e /tmp/screen-exchange +" as a user of Unix systems you *must* have this program! +" see also: http://www.math.fu-berlin.de/~guckes/screen/ +" +" Email/News - Editing replies/followups +" +" Part 1 - prepare for editing +" +" Part 2 - getting rid of empty (quoted) lines and space runs. +" +" ,cel = "clear empty lines" +" - delete the *contents* of all lines which contain only whitespace. +" note: this does not delete lines! +" map ,cel :g/^[ ]*$/d + map ,cel :%s/^\s\+$// +" ,del = "delete 'empty' lines" +" - delete all lines which contain only whitespace +" note: this does *not* delete empty lines! + map ,del :g/^\s\+$/d +" +" ,cqel = "clear quoted empty lines" +" Clears (makes empty) all lines which start with '>' +" and any amount of following spaces. +" nmap ,cqel :%s/^[> ]*$// +" vmap ,cqel :s/^[> ]*$// +" nmap ,cqel :%s/^[> ]\+$// +" vmap ,cqel :s/^[> ]\+$// + nmap ,cqel :%s/^[>]\+$// + vmap ,cqel :s/^[> ]\+$// +" NOTE: If the meta sequence "\s" +" The following do not work as "\s" is not a character +" and thus cannot be part of a "character set". +" map ,cqel :g/^[>\s]\+$/d +" +" Some people have strange habits within their writing. +" But if you cannot educate them - rewrite their text! ;-) +" +" Jason "triple-dots" King elephant@onaustralia.com.au +" does uses ".." or "..." rather than the usual punctuation +" (comma, semicolon, colon, full stop). So... +" +" Turning dot runs with following spaces into an end-of-sentence, +" ie dot-space-space: + vmap ,dot :s/\.\+ \+/. /g +" +" Gary Kline (kline@tera.tera.com) indents his +" own text in replies with TAB or spaces. +" Here's how to get rid of these indentation: + vmap ,gary :s/^>[ ]\+\([^>]\)/> \1/ +" +" ,ksr = "kill space runs" +" substitutes runs of two or more space to a single space: +" nmap ,ksr :%s/ */ /g +" vmap ,ksr :s/ */ /g + nmap ,ksr :%s/ \+/ /g + vmap ,ksr :s/ \+/ /g +" Why can't the removal of space runs be +" an option of "text formatting"? *hrmpf* +" +" ,Sel = "squeeze empty lines" +" Convert blocks of empty lines (not even whitespace included) +" into *one* empty line (within current visual): + map ,Sel :g/^$/,/./-j +" +" ,Sbl = "squeeze blank lines" +" Convert all blocks of blank lines (containing whitespace only) +" into *one* empty line (within current visual): +" map ,Sbl :g/^\s*$/,/[^ ]/-j +" map ,Sbl :g/^\s*$/,/[^ \t]/-j + map ,Sbl :g/^\s*$/,/\S/-j +" +" =================================================================== +" Editing of email replies and Usenet followups - using autocommands +" =================================================================== +" +" Remove ALL auto-commands. This avoids having the +" autocommands twice when the vimrc file is sourced again. +" autocmd! +" +" Let Vim identify itself when editing emails with Mutt: +" au! BufNewFile mutt* let @"="X-Editor: Vim-".version." http://www.vim.org\n"|exe 'norm 1G}""P' +" +" set the textwidth to 70 characters for replies (email&usenet) +" au BufNewFile,BufRead .letter,mutt*,nn.*,snd.* set tw=78 +" +" Try to use the mapping ",D" when doing a followup. +" autocmd BufNewFile ~/.followup ,D| +" +" Part 3 - Change Quoting Level +" +" ,dp = de-quote current inner paragraph +" map ,dp {jma}kmb:'a,'bs/^> // + map ,dp vip:s/^> // + vmap ,dp :s/^> // +" +" ,qp = quote current paragraph +" jump to first inner line, mark with 'a'; +" jump to last inner line, mark with 'b'; +" then do the quoting as a substitution +" on the line range "'a,'b": +" map ,qp {jma}kmb:'a,'bs/^/> / +" vim-5 now has selection of "inner" and "all" +" of current text object - mapping commented! +" +" ,qp = quote current paragraph (old version) +" jump to first inner line, Visual, +" jump to last inner line, +" then do the quoting as a substitution: +" map ,qp {jV}k:s/^/> / +" +" ,qp = quote current inner paragraph (works since vim-5.0q) +" select inner paragraph +" then do the quoting as a substitution: + map ,qp vip:s/^/> / +" +" ,qp = quote current paragraph +" just do the quoting as a substitution: + vmap ,qp :s/^/> / + +" +" Changing quote style to *the* true quote prefix string "> ": +" +" Fix Supercite aka PowerQuote (Hi, Andi! :-): +" before ,kpq: > Sven> text +" after ,kpq: > > text +" ,kpq kill power quote + vmap ,kpq :s/^> *[a-zA-Z]*>/> >/ +" +" Fix various other quote characters: +" ,fq "fix quoting" + vmap ,fq :s/^> \([-":}\|][ ]\)/> > / +" +" Part 4 - Weed Headers of quoted mail/post +" +" These mappings make use of the abbreviation that define a list of +" Email headers (HEMAIL) and News headers (HNEWS): + nmap ,we vip:v/HEMAIL/d + vmap ,we :v/HEMAIL/d + nmap ,wp vip:v/HNEWS/d + vmap ,wp :v/HNEWS/d +" +" Old versions for vim-4.6: +" ,we = "weed email header" +" nmap ,we !ipegrep "^(Date:\|From \|From:\|Subject:\|To:\|$)" +" vmap ,we !egrep "^(Date:\|From \|From:\|Subject:\|To:\|$)" +" ,wp = "weed post header" +" nmap ,wp !ipegrep "^(Date:\|From:\|Subject:\|Newsgroups:\|Followup-To:\|Keywords:\|References:\|Message-ID\|$)" +" vmap ,wp !egrep "^(Date:\|From:\|Subject:\|Newsgroups:\|Followup-To:\|Keywords:\|References:\|Message-ID\|$)" +" +" ,ri = "Read in" basic lines from the email header +" Useful when replying to an email: +" nmap ,ri :r!readmsg\|egrep "^From:\|^Subject:\|^Date:\|^To: \|^Cc:" +" NOTE: "readmsg" ships with the mailer ELM. +" +" +" Part 5 - Reformatting Text +" +" NOTE: The following mapping require formatoptions to include 'r' +" and "comments" to include "n:>" (ie "nested" comments with '>'). +" +" Formatting the current paragraph according to +" the current 'textwidth' with ^J (control-j): + imap gqap + map gqap +" +" ,b = break line in commented text (to be used on a space) +" nmap ,b dwi> + nmap ,b r +" ,j = join line in commented text +" (can be used anywhere on the line) +" nmap ,j Jxx + nmap ,j Vjgq +" +" ,B = break line at current position *and* join the next line +" nmap ,B i>Jxx + nmap ,B rVjgq +" +" ,,, break current line at current column, +" inserting ellipsis and "filling space": +" nmap ,,, ,,1,,2 +" nmap ,,1 a...X...FXrlmaky$o" +" nmap ,,2 :s/./ /g3X0"yy$dd`a"yP +" +" +" =================================================================== +" Edit your reply! (Or else!) +" =================================================================== +" +" Part 6 - Inserting Special or Standard Text +" Part 6a - The header + +" Add adresses for To: and Cc: lines +" +" ,ca = check alias (reads in expansion of alias name) +" map ,ca :r!elmalias -f "\%v (\%n)" +" ,Ca = check alias (reads in expansion of alias name) +" map ,Ca :r!elmalias -f "\%n <\%v>" +" +" ,cc = "copy notice" +" Insert a Cc line so that person will receive a "courtesy copy"; +" this tells the addressee that text is a copy of a public article. +" This assumes that there is exactly one empty line after the first +" paragraph and the first line of the second paragraph contains the +" return address with a trailing colon (which is later removed). + map ,cc 1G}jyykPICc: $x +" map ,cc ma1G}jy/ writes'aoCc: $p +" +" ,mlu = make letter urgent (by giving the "Priority: urgent") + map ,mlu 1G}OPriority: urgent +" +" Fixing the From: line +" +" ,cS = change Sven's address. + map ,cS 1G/^From: Sven Guckes/e+2C +" Used when replying as the "guy from vim". +" +" Fixing the Subject line +" +" Pet peeve: Unmeaningful Subject lines. Change them! +" ,cs = change Subject: line + map ,cs 1G/^Subject: yypIX-Old--W +" This command keeps the old Subject line in "X-Old-Subject:" - +" so the recipient can still search for it and +" you keep a copy for editing. +" +" +" ,re : Condense multiple "Re:_" to just one "Re:": + map ,re 1G/^Sub:s/\(Re: \)\+/Re: / +" +" ,Re : Change "Re: Re[n]" to "Re[n+1]" in Subject lines: + map ,Re 1G/^Subject: :s/Re: Re\[\([0-9]\+\)\]/Re[\1]/ +" +" Put parentheses around "visual text" +" Used when commenting out an old subject. +" Example: +" Subject: help +" Subject: vim - using autoindent (Re: help) +" +" ,) and ,( : + vmap ,( v``>a) + vmap ,) v``>a) +" +" Part 6 - Inserting Special or Standard Text +" Part 6a - Start of text - saying "hello". +" +" ,hi = "Hi!" (indicates first reply) + map ,hi 1G}oHi! +" +" ,ha = "helloagain" (indicates reply to reply) + map ,ha 1G}oHello, again! +" +" ,H = "Hallo, Du!" (German equivalent of "hi!" for replies) + map ,H G/Quoting /e+1ye1G}oHallo, !Po +" +" +" Part 6 - Inserting Special or Standard Text +" Part 6b - End of text - dealing with "signatures". +" +" remove signatures +" +" ,kqs = kill quoted sig (to remove those damn sigs for replies) +" goto end-of-buffer, search-backwards for a quoted sigdashes +" line, ie "^> -- $", and delete unto end-of-paragraph: + map ,kqs G?^> -- $d} +" map ,kqs G?^> *-- $dG +" ,kqs = kill quoted sig unto start of own signature: +" map ,kqs G?^> *-- $d/^-- $/ +" +" ,aq = "add quote" +" Reads in a quote from my favourite quotations: + nmap ,aq :r!agrep -d "^-- $" ~/.P/quotes/collectionb +" see http://www.math.fu-berlin.de/~guckes/quotes/collection +" +" ,s = "sign" - +" Read in signature file (requires manual completion): + nmap ,s :r!agrep -d "^-- $" ~/.P/sig/SIGS +" +" available as http://www.math.fu-berlin.de/~guckes/sig/SIGS +" +" ,S = signature addition of frequently used signatures + nmap ,SE :r!agrep -d "^-- $" comp.mail.elm ~/.P/sig/SIGS + nmap ,SM :r!agrep -d "^-- $" WOOF ~/.P/sig/SIGS + nmap ,SV :r!agrep -d "^-- $" IMproved ~/.P/sig/SIGS +" +" ,at = "add text" - +" read in text file (requires manual completion): + nmap ,at :r ~/.P/txt/ +" +" MUTT: Auto-kill signatures for replies +" map ,kqs G?^> *-- $dG +" autocmd BufNewFile,BufRead .followup,.letter,mutt*,nn.*,snd.* :normal ,kqs +" +" At the end of editing your reply you should check your spelling +" with the spelling checker "ispell". +" These mappings are from Lawrence Clapp lclapp@iname.com: +" spellcheck the document -- skip quoted text +" nmap :w ! grep -v '^>' \| spell +" vmap :w ! grep -v '^>' \| spell +" At home under Linux it looks something more like this: +" nmap :w ! grep -v '^>' \| ispell -??? +" +" Tell the recipient that I was replying to an old email of his: + ab SvenR Sven [finally takeing the time to reply to old emails] +" +" Toggles: [todo] +" +" toggle autoindent +" toggle hlsearch +" cycle textwidth between values 60, 70, 75, 80 +" +" =================================================================== +" HTML - HTML - HTML - HTML - HTML - HTML - HTML - HTML +" =================================================================== +" This has become quite big - so I moved it out to another file: +" http://www.math.fu-berlin.de/~guckes/vim/source/html.vim [980227] +" source ~guckes/.P/vim/source/html.vim +" +" =================================================================== +" LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX - LaTeX +" =================================================================== +" This has become quite big - so I moved it out to another file: +" http://www.math.fu-berlin.de/~guckes/vim/source/latex.vim +" source ~guckes/.P/vim/source/latex.vim +" +" =================================================================== +" PGP - encryption and decryption +" =================================================================== +" +" encrypt + map ;e :%!/bin/sh -c 'pgp -feast 2>/dev/tty' +" decrypt + map ;d :/^-----BEG/,/^-----END/!/bin/sh -c 'pgp -f 2>/dev/tty' +" sign + map ;s :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty' + map ;v :,/^-----END/w !pgp -m +" +" PGP - original mappings +" +" encrypt and sign (useful for mailing to someone else) +"csh: map #1 :,$! /bin/sh -c 'pgp -feast 2>/dev/tty^V|^V|sleep 4' +" sh: map #1 :,$! pgp -feast 2>/dev/tty^V|^V|sleep 4 +" +" sign (useful for mailing to someone else) +"csh: map #2 :,$! /bin/sh -c 'pgp -fast +clear 2>/dev/tty' +" sh: map #2 :,$! pgp -fast +clear 2>/dev/tty +" +" decrypt +"csh: map #3 :/^-----BEG/,/^-----END/!\ +" /bin/sh -c 'pgp -f 2>/dev/tty^V|^V|sleep 4' +" sh: map #3 :/^-----BEG/,/^-----END/!\ +" pgp -f 2>/dev/tty^V|^V|sleep 4 +" +" view (pages output, like more) +"csh: map #4 :,/^-----END/w !pgp -m +" sh: map #4 :,/^-----END/w !pgp -m +" +" encrypt alone (useful for encrypting for oneself) +"csh: map #5 :,$! /bin/sh -c 'pgp -feat 2>/dev/tty^V|^V|sleep 4' +" sh: map #5 :,$! pgp -feat 2>/dev/tty^V|^V|sleep 4 +" +" Elijah http://www.mathlab.sunysb.edu/~elijah/pgppub.html says : +" The significant feature is that stderr is redirected independently +" of stdout, and it is redirected to /dev/tty which is a synonym for +" the current terminal on Unix. I don't know why the ||sleep 4 +" stuff is there, but it is harmless so I left it. Since csh is such +" junk, special rules are used if you are using it (tcsh, too). +" ksh and bash should use the sh form. zsh, et al: consult your +" manual. The # format is used to map function keys. If your +" terminal does not support the requested function key, use a +" literal #. Not all of the clones correctly support this. +" +" =================================================================== +" Useful stuff. At least these are nice examples. :-) +" =================================================================== +" +" ,t = transpose two characters: from aXb -> bXa +" map ,t XplxhhPl +" This macros shortened by one character by +" Preben Guldberg c928400@student.dtu.dk +" map ,t XpxphXp +" map ,t xphXpxp +" +" make space move the cursor to the right - much better than a *beep* +" nmap \ l +" +" ,E = execute line +" map ,E 0/\$w"yy$:yr! +" This command excutes a shell command from the current line and +" reads in its output into the buffer. It assumes that the command +" starts with the fist word after the first '$' (the shell prompt +" of /bin/sh). Try ",E" on that line, ie place the cursor on it +" and then press ",E": +" $ ls -la +" Note: The command line commands have been remapped to tcsh style!! +" +" +" ,dr = decode/encode rot13 text + vmap ,dr :!tr A-Za-z N-ZA-Mn-za-m + +" Use this with an external "rot13" script: +" " ,13 - rot13 the visual text +" vmap ,13 :!rot13 +" +" Give the URL under the cursor to Netscape +" map ,net yA:!netscape -remote "openurl "" +" +" +" =================================================================== +" Mapping of special keys - arrow keys and function keys. +" =================================================================== +" Buffer commands (split,move,delete) - +" this makes a little more easy to deal with buffers. +" (works for Linux PCs in room 030) + map :split + map :bp + map :bn + map :bd +" +" Buffer commands (split,move,delete) - +" for Mac keyboard (Performa 5200, US keyboard) +" + map [19~ :split + map [20~ :bp + map [23~ :bn + map [31~ :bd +" +" Obvious mappings +" +" map +" map +" +" Emacs style editing in insert mode +" This is something I tried for a minute +" and forgot about the minute after. ;-) +" +" imap 0i +" imap hi +" imap xi +" imap A +" imap lli +" imap jli +" imap kli +" imap b bi +" imap f lWi +" +" Normal mode - tcsh style movements [960425] +" +" nmap 0 +" nmap h +" nmap x +" nmap $ +" nmap l +" nmap b b +" nmap f w +" +" DOS keyboard mapping for cursor keys +" +" map [A +" map [B +" map [C +" map [D +" imap [A +" imap [B +" imap [C +" imap [D +" +" DOS keyboard +" "insert" +" map [1~ i +" map [1~ +" "home" +" map [2~ ^ +" map [2~ 0 +" map [2~ +" "pgup" +" map [3~ +" map [3~ +" "delete" +" map [4~ x +" map [4~ +" "end" +" map [5~ $ +" map [5~ +" "pgdn" +" map [6~ +" map [6~ +" +" Keyboard mapping for cursor keys +" [works for SUNs in Solarium (room 030) - 970815] +" + map OA + map OB + map OC + map OD + imap OA + imap OB + imap OC + imap OD +" +" Keyboard mapping for cursor keys +" [works for XTerminals - 970818] + map [A + map [B + map [C + map [D + imap [A + imap [B + imap [C + imap [D +" +" =================================================================== +" AutoCommands +" =================================================================== +" +" Autocommands are the key to "syntax coloring". +" There's one command in your vimrc that should +" load/source the file $VIM/syntax/syntax.vim +" which contains the definition for colors and +" the autocommands that load other syntax files +" when necessary, ie when the filename matches +" a given pattern, eg "*.c" or *".html". +" +" just load the main syntax file when Vim was compiled with "+syntax" + if has("syntax") + " define my own syntax file (to be sourced t the end of syntax.vim): + " let mysyntaxfile="~guckes/.P/vim/syntax/syntax.vim" + " URL: http://www.math.fu-berlin.de/~guckes/vim/syntax/syntax.vim + " The main/standard syntax file: + so $VIMRUNTIME/syntax/syntax.vim + " + " Use my own syntax file on "mail/news messages": + let aucommand = "au BufNewFile,BufRead ".MAILNEWSFILES +" exe aucommand." source ~guckes/.P/vim/syntax/sven.vim" + " + hi! Comment term=bold ctermfg=cyan guifg=Blue + endif +" +" +" EXAMPLE: Restricting mappings to some files only: +" An autocommand does the macthign on the filenames - +" but abbreviations are not expanded within autocommands. +" Workaround: Use "exe" for expansion: +" let aucommand = "au BufNewFile,BufRead ".MAILNEWSFILES +" exe aucommand." :map ,hi 1G}oHi!" +" exe aucommand." :map ,ha 1G}oHello, again!" +" exe aucommand." :map ,H G/Quoting /e+1ye1G}oHallo, !Po" +" exe aucommand." :map ,re 1G}oRe!" +" +" Automatically place the cursor onto the first line of the mail body: +" autocmd BufNewFile,BufRead MAILNEWSFILES :normal 1G}j +" +" Toggle syntax coloring on/off with "__": +" nn __ mg:if has("syntax_items")syn clearelsesyn onen`g +" Note: It works - but the screen flashes are quite annoying. :-/ +" +" +" =================================================================== +" EXAMPLES +" =================================================================== +" +" Visualizing trailing whitespace: +" :set hls +" /\s\+$ +" +" Toggling a numerical variable between two values. +" Example: Switch the textwidth (tw) between values "70" and "80": +" map \1 :let &tw = 150 - &tw +" +" Capitalizing the previously typed word, +" returning to the previous position: +" imap CAP mzB~`za +" +" Uppercasing the previously typed word, +" returning to the previous position: +" imap CAP mzvBU`za +" imap CAP mzBvaWU`za +" +" =================================================================== +" TEMPORARY STUFF - TESTING THINGS +" =================================================================== +" +" View a html document (or part of it) with lynx. You need +" a system that supports the /def/fd/* file descriptors :-( +"nmap ,ly :w !lynx -force_html /dev/fd/0 +"vmap ,ly :w !lynx -force_html /dev/fd/0 +" +" Fri Jun 19 19:19:19 CEST 1998 +" Hi, Vikas! vikasa@att.com +" The key produces the code "OD" and Vikas wants to make +" Vim jump back one word in normal mode, ie using the command 'b': +" nmap OD b +" Works for me! :-) +" +" Some simple example of the "expand modifiers": +" insert the current filename *with* path: + iab YPATHFILE =expand("%:p") +" insert the current filename *without* path: + iab YFILE =expand("%:t:r") +" insert the path of current file: + iab YPATH =expand("%:h") +" +" #b = "browse" - send selected URL to Netscape + vmap #b y:!netscape -remote "openurl "" +" +" Toggle highlight search and report the current value: +" map #1 :set hls! +" map #2 :echo "HLSearch: " . strpart("OffOn",3*&hlsearch,3) +" map ## #1#2 +" +" Sorting current line containing a list of numbers +" map ## :s/ //gvip!sort -n +" +" Replying to the mutt mailing list: +" Remove header lines Cc: and Bcc: and insert [mutt] at the beginning +" map ,MM 1G/^Cc:2dd}o[mutt] +" +" map ,U %s###gc +" map ,F {jma}kmb:'a,'b!sed -e "s/^>//"|\ +" sed -f ~/.P/elm/scripts/weedout.sed +" map ,mb ebiEadw +" +" stripping netscape bookmarks and making them list items +" vmap ,ns :.,$s/^ *
<\(A.*"\) ADD.*">\(.*\)$/
  • <\1>\2/ +" +" Jump to the last space before the 80th column. +" map ,\| 80\|F +" +" extracting variable names from mutt's init.c +" :%s/^.*"\([a-z0-9_]*\)".*$/\1/ +" +" \<> = change to <> notation by substituting ^M and ^[ +" cab \<> s///gc:s///gc +" +" Changing the From_ line in pseudo mail folders to an appropriate +" value - so you can read them with a mailer. +" %s/^From /From guckes Thu Apr 6 12:07:00 1967/ +" +" =================================================================== +" ASCII tables - you may need them some day. Save them to a file! +" =================================================================== +" +" ASCII Table - | octal value - name/char | +" +" |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel| +" |010 bs |011 ht |012 nl |013 vt |014 np |015 cr |016 so |017 si | +" |020 dle|021 dc1|022 dc2|023 dc3|024 dc4|025 nak|026 syn|027 etb| +" |030 can|031 em |032 sub|033 esc|034 fs |035 gs |036 rs |037 us | +" |040 sp |041 ! |042 " |043 # |044 $ |045 % |046 & |047 ' | +" |050 ( |051 ) |052 * |053 + |054 , |055 - |056 . |057 / | +" |060 0 |061 1 |062 2 |063 3 |064 4 |065 5 |066 6 |067 7 | +" |070 8 |071 9 |072 : |073 ; |074 < |075 = |076 > |077 ? | +" |100 @ |101 A |102 B |103 C |104 D |105 E |106 F |107 G | +" |110 H |111 I |112 J |113 K |114 L |115 M |116 N |117 O | +" |120 P |121 Q |122 R |123 S |124 T |125 U |126 V |127 W | +" |130 X |131 Y |132 Z |133 [ |134 \ |135 ] |136 ^ |137 _ | +" |140 ` |141 a |142 b |143 c |144 d |145 e |146 f |147 g | +" |150 h |151 i |152 j |153 k |154 l |155 m |156 n |157 o | +" |160 p |161 q |162 r |163 s |164 t |165 u |166 v |167 w | +" |170 x |171 y |172 z |173 { |174 | |175 } |176 ~ |177 del| +" +" =================================================================== +" ASCII Table - | decimal value - name/char | +" +" |000 nul|001 soh|002 stx|003 etx|004 eot|005 enq|006 ack|007 bel| +" |008 bs |009 ht |010 nl |011 vt |012 np |013 cr |014 so |015 si | +" |016 dle|017 dc1|018 dc2|019 dc3|020 dc4|021 nak|022 syn|023 etb| +" |024 can|025 em |026 sub|027 esc|028 fs |029 gs |030 rs |031 us | +" |032 sp |033 ! |034 " |035 # |036 $ |037 % |038 & |039 ' | +" |040 ( |041 ) |042 * |043 + |044 , |045 - |046 . |047 / | +" |048 0 |049 1 |050 2 |051 3 |052 4 |053 5 |054 6 |055 7 | +" |056 8 |057 9 |058 : |059 ; |060 < |061 = |062 > |063 ? | +" |064 @ |065 A |066 B |067 C |068 D |069 E |070 F |071 G | +" |072 H |073 I |074 J |075 K |076 L |077 M |078 N |079 O | +" |080 P |081 Q |082 R |083 S |084 T |085 U |086 V |087 W | +" |088 X |089 Y |090 Z |091 [ |092 \ |093 ] |094 ^ |095 _ | +" |096 ` |097 a |098 b |099 c |100 d |101 e |102 f |103 g | +" |104 h |105 i |106 j |107 k |108 l |109 m |110 n |111 o | +" |112 p |113 q |114 r |115 s |116 t |117 u |118 v |119 w | +" |120 x |121 y |122 z |123 { |124 | |125 } |126 ~ |127 del| +" +" =================================================================== +" ASCII Table - | hex value - name/char | +" +" | 00 nul| 01 soh| 02 stx| 03 etx| 04 eot| 05 enq| 06 ack| 07 bel| +" | 08 bs | 09 ht | 0a nl | 0b vt | 0c np | 0d cr | 0e so | 0f si | +" | 10 dle| 11 dc1| 12 dc2| 13 dc3| 14 dc4| 15 nak| 16 syn| 17 etb| +" | 18 can| 19 em | 1a sub| 1b esc| 1c fs | 1d gs | 1e rs | 1f us | +" | 20 sp | 21 ! | 22 " | 23 # | 24 $ | 25 % | 26 & | 27 ' | +" | 28 ( | 29 ) | 2a * | 2b + | 2c , | 2d - | 2e . | 2f / | +" | 30 0 | 31 1 | 32 2 | 33 3 | 34 4 | 35 5 | 36 6 | 37 7 | +" | 38 8 | 39 9 | 3a : | 3b ; | 3c < | 3d = | 3e > | 3f ? | +" | 40 @ | 41 A | 42 B | 43 C | 44 D | 45 E | 46 F | 47 G | +" | 48 H | 49 I | 4a J | 4b K | 4c L | 4d M | 4e N | 4f O | +" | 50 P | 51 Q | 52 R | 53 S | 54 T | 55 U | 56 V | 57 W | +" | 58 X | 59 Y | 5a Z | 5b [ | 5c \ | 5d ] | 5e ^ | 5f _ | +" | 60 ` | 61 a | 62 b | 63 c | 64 d | 65 e | 66 f | 67 g | +" | 68 h | 69 i | 6a j | 6b k | 6c l | 6d m | 6e n | 6f o | +" | 70 p | 71 q | 72 r | 73 s | 74 t | 75 u | 76 v | 77 w | +" | 78 x | 79 y | 7a z | 7b { | 7c | | 7d } | 7e ~ | 7f del| +" =================================================================== +" +" =================================================================== +" If your read this... +" =================================================================== +" ... then please send me an email! Thanks! --Sven guckes@vim.org +" I have received some emails so far - thanks, folks! +" Enjoy Vim! :-) +" =================================================================== +" Yet another example for an autocommand: [980616] +" au VimLeave * echo "Thanks for using Vim"version". --Sven Guckes@vim.org!" +" =================================================================== +" Last but not least... +" ===================================================== +" The last line is allowed to be a "modeline" with my setup. +" It gives vim commands for setting variable values that are +" specific for editing this file. Used mostly for setting +" the textwidth (tw) and the "shiftwidth" (sw). +" Note that the colon within the value of "comments" needs to +" be escaped with a backslash! (Thanks, Thomas!) +" vim:tw=70 et sw=4 comments=\:\" + +hi Normal guibg=#000000 guifg=#FFFFFF +set sw=2 ts=2 tw=0 wm=0 nowrap cindent +set shellpipe=2> +set comments=sr:/**,m:*\ ,e:*/,://,b:#,:%,:XCOMM,n:>,n:\:,fb:- + +augroup Perl + autocmd! + autocmd BufEnter *.pl set sw=2 ts=2 tw=0 wm=0 nowrap si +augroup END + +augroup Email + autocmd! + autocmd BufEnter /var/tmp/pico.* set tw=70 +augroup END + +set expandtab +set tabstop=4 +set shiftwidth=4